Limba
|
APrEST88082-100ul, PrEST Antigen EID2B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EID2B, Gene description: EP300 interacting inhibitor of differentiation 2B, Alternative Gene Names: EID-3, FLJ38944, Antigen sequence: QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EID2B, Gene description: EP300 interacting inhibitor of differentiation 2B, Alternative Gene Names: EID-3, FLJ38944, Antigen sequence: QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|