Limba
|
APrEST82817-100ul, PrEST Antigen EID2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EID2, Gene description: EP300 interacting inhibitor of differentiation 2, Alternative Gene Names: CRI2, EID-2, MGC20452, Antigen sequence: AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EID2, Gene description: EP300 interacting inhibitor of differentiation 2, Alternative Gene Names: CRI2, EID-2, MGC20452, Antigen sequence: AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|