APrEST81562-100ul, PrEST Antigen EID1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EID1, Gene description: EP300 interacting inhibitor of differentiation 1, Alternative Gene Names: C15orf3, CRI1, EID-1, Antigen sequence: DEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EID1, Gene description: EP300 interacting inhibitor of differentiation 1, Alternative Gene Names: C15orf3, CRI1, EID-1, Antigen sequence: DEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|