APrEST86317-100ul, PrEST Antigen EID3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EID3, Gene description: EP300 interacting inhibitor of differentiation 3, Alternative Gene Names: FLJ25832, NSE4B, NSMCE4B, Antigen sequence: PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EID3, Gene description: EP300 interacting inhibitor of differentiation 3, Alternative Gene Names: FLJ25832, NSE4B, NSMCE4B, Antigen sequence: PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|