APrEST81133-100ul, PrEST Antigen TMTC3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMTC3, Gene description: transmembrane and tetratricopeptide repeat containing 3, Alternative Gene Names: FLJ90492, SMILE, Antigen sequence: RQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TMTC3, Gene description: transmembrane and tetratricopeptide repeat containing 3, Alternative Gene Names: FLJ90492, SMILE, Antigen sequence: RQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|