APrEST94758-100ul, PrEST Antigen TMTC4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMTC4, Gene description: transmembrane and tetratricopeptide repeat containing 4, Alternative Gene Names: FLJ14624, FLJ22153, Antigen sequence: LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TMTC4, Gene description: transmembrane and tetratricopeptide repeat containing 4, Alternative Gene Names: FLJ14624, FLJ22153, Antigen sequence: LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|