APrEST72637-100ul, PrEST Antigen TMTC2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMTC2, Gene description: transmembrane and tetratricopeptide repeat containing 2, Alternative Gene Names: DKFZp762A217, Antigen sequence: KSPSVDRECNGKTVTNGKQNANGHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTEN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TMTC2, Gene description: transmembrane and tetratricopeptide repeat containing 2, Alternative Gene Names: DKFZp762A217, Antigen sequence: KSPSVDRECNGKTVTNGKQNANGHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTEN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|