APrEST73034-100ul, PrEST Antigen TIMM23 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM23, Gene description: translocase of inner mitochondrial membrane 23 homolog (yeast), Alternative Gene Names: TIM23, Antigen sequence: TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIMM23, Gene description: translocase of inner mitochondrial membrane 23 homolog (yeast), Alternative Gene Names: TIM23, Antigen sequence: TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|