Limba
|
APrEST82743-100ul, PrEST Antigen TIMM29 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM29, Gene description: translocase of inner mitochondrial membrane 29, Antigen sequence: LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIMM29, Gene description: translocase of inner mitochondrial membrane 29, Antigen sequence: LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|