APrEST86874-100ul, PrEST Antigen TIMM22 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM22, Gene description: translocase of inner mitochondrial membrane 22 homolog (yeast), Alternative Gene Names: TEX4, Antigen sequence: GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TIMM22, Gene description: translocase of inner mitochondrial membrane 22 homolog (yeast), Alternative Gene Names: TEX4, Antigen sequence: GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|