APrEST95861-100ul, PrEST Antigen LRCH2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRCH2, Gene description: leucine rich repeats and calponin homology domain containing 2, Alternative Gene Names: KIAA1495, Antigen sequence: RNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LRCH2, Gene description: leucine rich repeats and calponin homology domain containing 2, Alternative Gene Names: KIAA1495, Antigen sequence: RNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|