APrEST72364-100ul, PrEST Antigen LRCH3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRCH3, Gene description: leucine-rich repeats and calponin homology (CH) domain containing 3, Alternative Gene Names: MGC4126, Antigen sequence: HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LRCH3, Gene description: leucine-rich repeats and calponin homology (CH) domain containing 3, Alternative Gene Names: MGC4126, Antigen sequence: HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|