Limba
|
APrEST95718-100ul, PrEST Antigen CFAP99 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CFAP99, Gene description: cilia and flagella associated protein 99, Antigen sequence: RLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CFAP99, Gene description: cilia and flagella associated protein 99, Antigen sequence: RLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|