APrEST84106-100ul, PrEST Antigen CFAP97 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CFAP97, Gene description: cilia and flagella associated protein 97, Alternative Gene Names: DKFZp434F1728, Antigen sequence: EGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTTENYLTEKGNERNVKFPPEHPVENDVTQTVSSFSLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CFAP97, Gene description: cilia and flagella associated protein 97, Alternative Gene Names: DKFZp434F1728, Antigen sequence: EGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTTENYLTEKGNERNVKFPPEHPVENDVTQTVSSFSLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|