APrEST95048-100ul, PrEST Antigen GPRIN2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GPRIN2, Gene description: G protein regulated inducer of neurite outgrowth 2, Alternative Gene Names: KIAA0514, MGC15171, Antigen sequence: NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen GPRIN2, Gene description: G protein regulated inducer of neurite outgrowth 2, Alternative Gene Names: KIAA0514, MGC15171, Antigen sequence: NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|