APrEST89347-100ul, PrEST Antigen GPRIN1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GPRIN1, Gene description: G protein regulated inducer of neurite outgrowth 1, Alternative Gene Names: GRIN1, KIAA1893, Antigen sequence: EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen GPRIN1, Gene description: G protein regulated inducer of neurite outgrowth 1, Alternative Gene Names: GRIN1, KIAA1893, Antigen sequence: EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|