APrEST92230-100ul, PrEST Antigen ACAP1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ACAP1, Gene description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1, Alternative Gene Names: CENTB1, KIAA0050, Antigen sequence: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ACAP1, Gene description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1, Alternative Gene Names: CENTB1, KIAA0050, Antigen sequence: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|