APrEST79322-100ul, PrEST Antigen ACAP2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ACAP2, Gene description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 2, Alternative Gene Names: CENTB2, CNT-B2, KIAA0041, Antigen sequence: LCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ACAP2, Gene description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 2, Alternative Gene Names: CENTB2, CNT-B2, KIAA0041, Antigen sequence: LCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|