APrEST91907-100ul, PrEST Antigen BACH2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BACH2, Gene description: BTB and CNC homology 1, basic leucine zipper transcription factor 2, Alternative Gene Names: BTBD25, Antigen sequence: SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen BACH2, Gene description: BTB and CNC homology 1, basic leucine zipper transcription factor 2, Alternative Gene Names: BTBD25, Antigen sequence: SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|