APrEST90791-100ul, PrEST Antigen BACH1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BACH1, Gene description: BTB and CNC homology 1, basic leucine zipper transcription factor 1, Alternative Gene Names: BACH-1, BTBD24, Antigen sequence: LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen BACH1, Gene description: BTB and CNC homology 1, basic leucine zipper transcription factor 1, Alternative Gene Names: BACH-1, BTBD24, Antigen sequence: LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|