APrEST91721-100ul, PrEST Antigen CREG1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CREG1, Gene description: cellular repressor of E1A-stimulated genes 1, Alternative Gene Names: CREG, Antigen sequence: YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CREG1, Gene description: cellular repressor of E1A-stimulated genes 1, Alternative Gene Names: CREG, Antigen sequence: YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|