Limba
|
APrEST79207-100ul, PrEST Antigen CREG2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CREG2, Gene description: cellular repressor of E1A-stimulated genes 2, Antigen sequence: RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CREG2, Gene description: cellular repressor of E1A-stimulated genes 2, Antigen sequence: RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|