APrEST91471-100ul, PrEST Antigen NFATC2IP Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NFATC2IP, Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein, Alternative Gene Names: ESC2, FLJ14639, NIP45, RAD60, Antigen sequence: SPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen NFATC2IP, Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein, Alternative Gene Names: ESC2, FLJ14639, NIP45, RAD60, Antigen sequence: SPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|