APrEST70871-100ul, PrEST Antigen NFATC2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NFATC2, Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2, Alternative Gene Names: NF-ATP, NFAT1, NFATp, Antigen sequence: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen NFATC2, Gene description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2, Alternative Gene Names: NF-ATP, NFAT1, NFATp, Antigen sequence: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|