APrEST91197-100ul, PrEST Antigen TICRR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TICRR, Gene description: TOPBP1-interacting checkpoint and replication regulator, Alternative Gene Names: C15orf42, FLJ41618, MGC45866, SLD3, Treslin, Antigen sequence: DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TICRR, Gene description: TOPBP1-interacting checkpoint and replication regulator, Alternative Gene Names: C15orf42, FLJ41618, MGC45866, SLD3, Treslin, Antigen sequence: DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|