Limba
|
APrEST84287-100ul, PrEST Antigen TIFAB Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIFAB, Gene description: TRAF-interacting protein with forkhead-associated domain, family member B, Antigen sequence: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIFAB, Gene description: TRAF-interacting protein with forkhead-associated domain, family member B, Antigen sequence: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|