APrEST90820-100ul, PrEST Antigen FCER1A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FCER1A, Gene description: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, Alternative Gene Names: FCE1A, Antigen sequence: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FCER1A, Gene description: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, Alternative Gene Names: FCE1A, Antigen sequence: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|