APrEST82711-100ul, PrEST Antigen FBXW9 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FBXW9, Gene description: F-box and WD repeat domain containing 9, Alternative Gene Names: Fbw9, MGC10870, Antigen sequence: VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FBXW9, Gene description: F-box and WD repeat domain containing 9, Alternative Gene Names: Fbw9, MGC10870, Antigen sequence: VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|