Limba
|
APrEST88834-100ul, PrEST Antigen ZBTB3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB3, Gene description: zinc finger and BTB domain containing 3, Alternative Gene Names: FLJ23392, Antigen sequence: MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGTMEFPEHSQQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZBTB3, Gene description: zinc finger and BTB domain containing 3, Alternative Gene Names: FLJ23392, Antigen sequence: MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGTMEFPEHSQQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|