Limba
|
APrEST75381-100ul, PrEST Antigen ZBTB26 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB26, Gene description: zinc finger and BTB domain containing 26, Alternative Gene Names: ZNF481, Antigen sequence: SPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVSEIEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZBTB26, Gene description: zinc finger and BTB domain containing 26, Alternative Gene Names: ZNF481, Antigen sequence: SPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVSEIEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|