APrEST87165-100ul, PrEST Antigen TOMM40 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TOMM40, Gene description: translocase of outer mitochondrial membrane 40 homolog (yeast), Alternative Gene Names: C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40, Antigen sequence: AQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TOMM40, Gene description: translocase of outer mitochondrial membrane 40 homolog (yeast), Alternative Gene Names: C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40, Antigen sequence: AQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|