APrEST85640-100ul, PrEST Antigen TOMM40L Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TOMM40L, Gene description: translocase of outer mitochondrial membrane 40 homolog (yeast)-like, Alternative Gene Names: FLJ12770, TOMM40B, Antigen sequence: VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TOMM40L, Gene description: translocase of outer mitochondrial membrane 40 homolog (yeast)-like, Alternative Gene Names: FLJ12770, TOMM40B, Antigen sequence: VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|