Limba
|
APrEST85007-100ul, PrEST Antigen SKA2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SKA2, Gene description: spindle and kinetochore associated complex subunit 2, Alternative Gene Names: FAM33A, FLJ12758, Antigen sequence: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SKA2, Gene description: spindle and kinetochore associated complex subunit 2, Alternative Gene Names: FAM33A, FLJ12758, Antigen sequence: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|