APrEST81670-100ul, PrEST Antigen SKA1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SKA1, Gene description: spindle and kinetochore associated complex subunit 1, Alternative Gene Names: C18orf24, MGC10200, Antigen sequence: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SKA1, Gene description: spindle and kinetochore associated complex subunit 1, Alternative Gene Names: C18orf24, MGC10200, Antigen sequence: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|