APrEST84268-100ul, PrEST Antigen SMCO1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SMCO1, Gene description: single-pass membrane protein with coiled-coil domains 1, Alternative Gene Names: C3orf43, DKFZp313B0440, FLJ41923, Antigen sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SMCO1, Gene description: single-pass membrane protein with coiled-coil domains 1, Alternative Gene Names: C3orf43, DKFZp313B0440, FLJ41923, Antigen sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|