APrEST81743-100ul, PrEST Antigen SMCHD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SMCHD1, Gene description: structural maintenance of chromosomes flexible hinge domain containing 1, Alternative Gene Names: KIAA0650, Antigen sequence: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SMCHD1, Gene description: structural maintenance of chromosomes flexible hinge domain containing 1, Alternative Gene Names: KIAA0650, Antigen sequence: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|