APrEST84109-100ul, PrEST Antigen TMUB2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMUB2, Gene description: transmembrane and ubiquitin-like domain containing 2, Alternative Gene Names: MGC3123, Antigen sequence: LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TMUB2, Gene description: transmembrane and ubiquitin-like domain containing 2, Alternative Gene Names: MGC3123, Antigen sequence: LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|