APrEST73045-100ul, PrEST Antigen TMUB1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMUB1, Gene description: transmembrane and ubiquitin-like domain containing 1, Alternative Gene Names: C7orf21, SB144, Antigen sequence: ATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TMUB1, Gene description: transmembrane and ubiquitin-like domain containing 1, Alternative Gene Names: C7orf21, SB144, Antigen sequence: ATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|