Limba
|
APrEST82834-100ul, PrEST Antigen BSPH1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BSPH1, Gene description: binder of sperm protein homolog 1, Alternative Gene Names: BSP1, ELSPBP2, Antigen sequence: SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen BSPH1, Gene description: binder of sperm protein homolog 1, Alternative Gene Names: BSP1, ELSPBP2, Antigen sequence: SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|