APrEST75212-100ul, PrEST Antigen BSPRY Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BSPRY, Gene description: B-box and SPRY domain containing, Alternative Gene Names: FLJ20150, Antigen sequence: NSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen BSPRY, Gene description: B-box and SPRY domain containing, Alternative Gene Names: FLJ20150, Antigen sequence: NSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|