APrEST82567-100ul, PrEST Antigen FSD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FSD1, Gene description: fibronectin type III and SPRY domain containing 1, Alternative Gene Names: MGC3213, MIR1, Antigen sequence: AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FSD1, Gene description: fibronectin type III and SPRY domain containing 1, Alternative Gene Names: MGC3213, MIR1, Antigen sequence: AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|