APrEST75190-100ul, PrEST Antigen FSD1L Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FSD1L, Gene description: fibronectin type III and SPRY domain containing 1-like, Alternative Gene Names: CCDC10, CSDUFD1, FSD1CL, FSD1NL, Antigen sequence: MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FSD1L, Gene description: fibronectin type III and SPRY domain containing 1-like, Alternative Gene Names: CCDC10, CSDUFD1, FSD1CL, FSD1NL, Antigen sequence: MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|