APrEST81581-100ul, PrEST Antigen ANKDD1A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKDD1A, Gene description: ankyrin repeat and death domain containing 1A, Alternative Gene Names: FLJ25870, Antigen sequence: LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ANKDD1A, Gene description: ankyrin repeat and death domain containing 1A, Alternative Gene Names: FLJ25870, Antigen sequence: LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|