APrEST79132-100ul, PrEST Antigen ANKAR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKAR, Gene description: ankyrin and armadillo repeat containing, Alternative Gene Names: FLJ25415, Antigen sequence: QLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMDIDPDGKPQTNKDIFSEFSSAGLTDITKDPDFNEIYDEDVNEDP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ANKAR, Gene description: ankyrin and armadillo repeat containing, Alternative Gene Names: FLJ25415, Antigen sequence: QLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMDIDPDGKPQTNKDIFSEFSSAGLTDITKDPDFNEIYDEDVNEDP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|