APrEST80643-100ul, PrEST Antigen UBASH3B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B, Alternative Gene Names: KIAA1959, STS-1, Antigen sequence: AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B, Alternative Gene Names: KIAA1959, STS-1, Antigen sequence: AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|