APrEST78827-100ul, PrEST Antigen UBASH3A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A, Alternative Gene Names: CLIP4, STS-2, TULA, Antigen sequence: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A, Alternative Gene Names: CLIP4, STS-2, TULA, Antigen sequence: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|