APrEST80211-100ul, PrEST Antigen SPOCK2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPOCK2, Gene description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2, Alternative Gene Names: KIAA0275, testican-2, Antigen sequence: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SPOCK2, Gene description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2, Alternative Gene Names: KIAA0275, testican-2, Antigen sequence: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|