APrEST70160-100ul, PrEST Antigen SPOCK1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPOCK1, Gene description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1, Alternative Gene Names: SPOCK, testican-1, TIC1, Antigen sequence: FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SPOCK1, Gene description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1, Alternative Gene Names: SPOCK, testican-1, TIC1, Antigen sequence: FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|