Limba
|
APrEST73032-100ul, PrEST Antigen TMCO3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMCO3, Gene description: transmembrane and coiled-coil domains 3, Alternative Gene Names: C13orf11, FLJ20623, Antigen sequence: RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TMCO3, Gene description: transmembrane and coiled-coil domains 3, Alternative Gene Names: C13orf11, FLJ20623, Antigen sequence: RIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGMLVTQDVQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|