APrEST72933-100ul, PrEST Antigen TMCO4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TMCO4, Gene description: transmembrane and coiled-coil domains 4, Alternative Gene Names: DKFZp686C23231, Antigen sequence: QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TMCO4, Gene description: transmembrane and coiled-coil domains 4, Alternative Gene Names: DKFZp686C23231, Antigen sequence: QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|